HORDB

ID: hor002384
Uniprot ID: Q9XSE2(26-116)
Protein name: Promotilin
Gene name: MLN
Organism: Felis catus (Cat) (Felis silvestris catus)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: FVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
Length: 91(26-116)
Propeptide: MVSRKAVAVLLMVHVAVMLASQTEAFVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
Signal peptide: MVSRKAVAVLLMVHVAVMLASQTEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002384_AF2.pdb

hor002384_ESM.pdb

Mass:	1202437	Formula:	C457H757N133O142S
Absent amino acids:	CW	Common amino acids:	E
pI:	5.94	Basic residues:	16
Polar residues:	17	Hydrophobic residues:	29
Hydrophobicity:	-74.51	Boman Index:	-23156
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	92.09
Instability Index:	6099.78	Extinction Coefficient cystines:	1490
Absorbance 280nm:	16.56